

Last commit

Scan BAM for upstream-ORF. Inspired from https://github.com/ImperialCardioGenetics/uORFs


Usage: vcfscanupstreamorf [options] Files
      Export an archive containing the fasta+bed of the uORF is created and 
      the program exits. An existing directory or a filename ending with the 
      '.zip' or '.tar' or '.tar.gz' suffix.
      If this program writes a VCF to a file, The format is first guessed from 
      the file suffix. Otherwise, force BCF output. The current supported BCF 
      version is : 2.1 which is not compatible with bcftools/htslib (last 
      checked 2019-11-15)
      Default: false
      reduce the number of transcripts. Keep one if some share the same UTR
      Default: false
      disable scan for ATG creation
      Default: false
      disable scan for ATG deletion
      Default: false
      disable scan for STOP creation
      Default: false
      disable scan for STOP deletion
      Default: false
      remove a uORF it if enterely overlaps a coding region of the exon of an 
      alternative transcript.
      Default: false
      Generate MD5 checksum for VCF output.
      Default: false
  * -gtf, --gtf
      A GTF (General Transfer Format) file. See 
      https://www.ensembl.org/info/website/upload/gff.html . Please note that 
      CDS are only detected if a start and stop codons are defined.
    -h, --help
      print help and exit
      What kind of help. One of [usage,markdown,xml].
      disable scan for Kozak change
      Default: false
    -o, --out
      Output file. Optional . Default: stdout
  * -r, -R, --reference
      Indexed fasta Reference file. This file must be indexed with samtools 
      faidx and with picard CreateSequenceDictionary
      only accept events that are related to 'Strong' Kozak pattern.
      Default: false
      only print variants having something to say about an uorf
      Default: false
      print version and exit



Requirements / Dependencies

Download and Compile

$ git clone "https://github.com/lindenb/jvarkit.git"
$ cd jvarkit
$ ./gradlew vcfscanupstreamorf

The java jar file will be installed in the dist directory.

Creation Date


Source code


Unit Tests




The project is licensed under the MIT license.


Should you cite vcfscanupstreamorf ? https://github.com/mr-c/shouldacite/blob/master/should-I-cite-this-software.md

The current reference is:


Lindenbaum, Pierre (2015): JVarkit: java-based utilities for Bioinformatics. figshare. http://dx.doi.org/10.6084/m9.figshare.1425030


part of this code was inspired from: https://github.com/ImperialCardioGenetics/uORFs/blob/master/5primeUTRannotator/five_prime_UTR_annotator.pm


Example 1

 wget -q -O - "https://storage.googleapis.com/gnomad-public/release/2.1/vcf/genomes/gnomad.genomes.r2.1.sites.chr1.vcf.bgz" |\
 bcftools annotate -x "INFO,FILTER" |\
 java -jar /home/lindenb/src/jvarkit-git/dist/vcfscanupstreamorf.jar \
 	-R human_g1k_v37.fasta  --uorf-only  --canonical  

1	89333	rs1008713359	A	G	283.15	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:C|atg-pos:89334|cap-atg:2708|atg-cds:40|atg-frame:atg-out-of-cds-frame|kozak-seq:GAAATGC|kozak-strength:Moderate|stop-frame:not-in-frame-stop|stop-pos:89318|atg-stop:16|pep:.
1	89359	rs1327179626	C	T	3839.47	.	UORF_ADD_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:A|atg-pos:89359|cap-atg:2683|atg-cds:65|atg-frame:atg-out-of-cds-frame|kozak-seq:TGCATGT|kozak-strength:Weak|stop-frame:in-frame-stop|stop-pos:89356|atg-stop:3|pep:M
1	89391	rs1332733110	T	C	2045.80	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:G|atg-pos:89391|cap-atg:2651|atg-cds:97|atg-frame:atg-out-of-cds-frame|kozak-seq:TGAATGA|kozak-strength:Weak|stop-frame:in-frame-stop|stop-pos:89382|atg-stop:9|pep:VNK
1	89555	rs1200434471	A	C	283.62	.	UORF_ADD_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:G|atg-pos:89557|cap-atg:2485|atg-cds:263|atg-frame:atg-out-of-cds-frame|kozak-seq:GAAATGA|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89452|atg-stop:105|pep:MKSQNVSQKIIYNVCVRKRQYPSNFESLHQKENSK,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:G|atg-pos:89557|cap-atg:1312|atg-cds:7|atg-frame:atg-out-of-cds-frame|kozak-seq:GAAATGA|kozak-strength:Moderate|stop-frame:not-in-frame-stop|stop-pos:89556|atg-stop:1|pep:.
1	89560	rs1234719556	C	A	448.62	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:T|atg-pos:89562|cap-atg:2480|atg-cds:268|atg-frame:atg-out-of-cds-frame|kozak-seq:TGAATGA|kozak-strength:Weak|stop-frame:in-frame-stop|stop-pos:89541|atg-stop:21|pep:IKLKVKM,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:T|atg-pos:89562|cap-atg:1307|atg-cds:12|atg-frame:atg-in-cds-frame|kozak-seq:TGAATGA|kozak-strength:Weak|stop-frame:not-in-frame-stop|stop-pos:89555|atg-stop:7|pep:.
1	89624	rs1166058274	T	C	606.05	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:G|atg-pos:89624|cap-atg:2418|atg-cds:330|atg-frame:atg-in-cds-frame|kozak-seq:ACAATGA|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89609|atg-stop:15|pep:VKELF,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:G|atg-pos:89624|cap-atg:1245|atg-cds:74|atg-frame:atg-out-of-cds-frame|kozak-seq:ACAATGA|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89609|atg-stop:15|pep:VKELF
1	89718	rs865856422	A	G	1466.11	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:C|atg-pos:89719|cap-atg:2323|atg-cds:425|atg-frame:atg-out-of-cds-frame|kozak-seq:AAAATGA|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89710|atg-stop:9|pep:TKL,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:C|atg-pos:89719|cap-atg:1150|atg-cds:169|atg-frame:atg-out-of-cds-frame|kozak-seq:AAAATGA|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89710|atg-stop:9|pep:TKL
1	89831	rs1209426147	A	G	372.62	.	UORF_DEL_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:C|atg-pos:89832|cap-atg:2210|atg-cds:538|atg-frame:atg-out-of-cds-frame|kozak-seq:CTTATGT|kozak-strength:Weak|stop-frame:in-frame-stop|stop-pos:89811|atg-stop:21|pep:TFAIYHT,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:C|atg-pos:89832|cap-atg:1037|atg-cds:282|atg-frame:atg-in-cds-frame|kozak-seq:CTTATGT|kozak-strength:Weak|stop-frame:in-frame-stop|stop-pos:89811|atg-stop:21|pep:TFAIYHT
1	89945	rs1376722481	G	C	297.51	.	UORF_ADD_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:G|atg-pos:89947|cap-atg:2095|atg-cds:653|atg-frame:atg-out-of-cds-frame|kozak-seq:AATATGC|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89803|atg-stop:144|pep:MPLASVSHLAKPRLRSGKMEAISSWERRQRRWEYYVATYVCNLPYLAL,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:G|atg-pos:89947|cap-atg:922|atg-cds:397|atg-frame:atg-out-of-cds-frame|kozak-seq:AATATGC|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89803|atg-stop:144|pep:MPLASVSHLAKPRLRSGKMEAISSWERRQRRWEYYVATYVCNLPYLAL
1	90032	rs866094671	C	T	14378.50	.	UORF_ADD_ATG=transcript:ENST00000466430.1|strand:-|utr-start:89295|utr-end:120932|alt:A|atg-pos:90032|cap-atg:2010|atg-cds:738|atg-frame:atg-in-cds-frame|kozak-seq:TTCATGG|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89951|atg-stop:81|pep:MGQLVSRAARETKPQCTFYSLCAHQTC,transcript:ENST00000495576.1|strand:-|utr-start:89551|utr-end:91105|alt:A|atg-pos:90032|cap-atg:837|atg-cds:482|atg-frame:atg-out-of-cds-frame|kozak-seq:TTCATGG|kozak-strength:Moderate|stop-frame:in-frame-stop|stop-pos:89951|atg-stop:81|pep:MGQLVSRAARETKPQCTFYSLCAHQTC

extract to bed format

track name="uORF" description="uORF for http://hgdownload.cse.ucsc.edu/goldenPath/hg19/database/wgEncodeGencodeBasicV19.txt.gz"
#chrom	chromStart	chromEnd	name	score	strand	thickStart	thickEnd	itemRgb	blockCount	blockSizes	blockStarts
chr1	34553	36081	ENST00000417324.1.uorf	100	-	35140	35736	0,0,255	1	1528	0
chr1	89294	120932	ENST00000466430.1.uorf	500	-	91254	91491	0,255,0	1	31638	0
chr1	89550	91105	ENST00000495576.1.uorf	100	-	90431	90590	0,0,255	1	1555	0
chr1	139789	140339	ENST00000493797.1.uorf	500	-	139816	140223	0,255,0	1	550	0
chr1	141473	149707	ENST00000484859.1.uorf	1000	-	146708	146978	255,0,0	1	8234	0
chr1	142807	146831	ENST00000490997.1.uorf	1000	-	142988	146482	255,0,0	1	4024	0
chr1	157783	157887	ENST00000410691.1.uorf	0	-	157848	157887	0,0,0	1	104	0
chr1	236111	267253	ENST00000424587.2.uorf	100	-	236759	236918	0,0,255	1	31142	0
chr1	453632	460480	ENST00000450983.1.uorf	1000	-	453980	454166	255,0,0	1	6848	0
chr1	521368	523833	ENST00000417636.1.uorf	500	-	522285	523620	0,255,0	1	2465	0
chr1	529838	532878	ENST00000357876.5.uorf	500	-	530001	532684	0,255,0	1	3040	0
chr1	562756	564390	ENST00000452176.1.uorf	500	-	562878	562995	0,255,0	1	1634	0
chr1	646721	655580	ENST00000414688.1.uorf	500	-	647189	655553	0,255,0	1	8859	0
chr1	677192	685396	ENST00000416385.1.uorf	100	-	682910	683180	0,0,255	1	8204	0
chr1	693612	693716	ENST00000411249.1.uorf	0	-	693689	693716	0,0,0	1	104	0
chr1	694411	700305	ENST00000417659.1.uorf	100	-	700133	700208	0,0,255	1	5894	0
chr1	700236	714006	ENST00000428504.1.uorf	500	-	705034	709660	0,255,0	1	13770	0
chr1	736258	745541	ENST00000447500.1.uorf	500	-	741231	745515	0,255,0	1	9283	0
chr1	745488	753092	ENST00000435300.1.uorf	500	-	752900	753047	0,255,0	1	7604	0
chr1	761585	762902	ENST00000473798.1.uorf	500	-	762082	762571	0,255,0	1	1317	0
chr1	803450	812283	ENST00000446136.1.uorf	100	-	810390	812268	0,0,255	1	8833	0
chr1	852249	855072	ENST00000417705.1.uorf	100	-	852976	854794	0,0,255	1	2823	0
chr1	889805	894689	ENST00000487214.1.uorf	1000	-	889839	894620	255,0,0	1	4884	0
chr1	916546	917473	ENST00000341290.2.uorf	1000	-	916549	917473	255,0,0	1	927	0
chr1	931345	933431	ENST00000606034.1.uorf	100	-	931510	932137	0,0,255	1	2086	0
chr1	935353	935552	ENST00000428771.2.uorf	500	-	935487	935544	0,255,0	1	199	0
chr1	947376	948573	ENST00000458555.1.uorf	100	-	947459	947507	0,0,255	1	1197	0
chr1	997587	998668	ENST00000442292.2.uorf	500	-	997810	998119	0,255,0	1	1081	0
chr1	1019305	1051623	ENST00000482816.1.uorf	1000	-	1019401	1026923	255,0,0	1	32318	0
chr1	1026923	1027554	ENST00000379320.1.uorf	100	-	1027028	1027400	0,0,255	1	631	0
chr1	1026923	1041507	ENST00000379319.1.uorf	100	-	1041338	1041410	0,0,255	1	14584	0